Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F2C8F9
dbSWEET id: dbswt_1766
Accession: F2C8F9
Uniprot status: Unreviewed
Organism: Streptococcus sanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F2C8F9|F2C8F9_STRSA|Unreviewed|Streptococcus sanguinis|92
MKETIKMSEKQMKILGWVATFMSVMMYVSYFPQIMNNLAGQKGNFIQPLVAAINCSLWVY
YGLFKKERDIPLAAANAPGIVFGLVTAITALI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 16 Model end: 92 Inward Open: Template: 4X5M.pdb Model structure: F2C8F9_inward.pdb Alignment file: F2C8F9_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 9.2% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F2C8F9_outward.pdb Alignment file: F2C8F9_out.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 7.7% allowed .0% week .0% disallowed Occluded: Model structure: F2C8F9_occluded.pdb Alignment file: F2C8F9_occ.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.2% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA