Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F2B915

dbSWEET id: dbswt_1763

Accession:   F2B915

Uniprot status:   Unreviewed

Organism:   Neisseria bacilliformis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Neisseria.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|F2B915|F2B915_9NEIS|Unreviewed|Neisseria bacilliformis|88
MISKAKFNTFVGSIGAAMGIFVFVAYIPQIIANMQGAKAQPWQPLFAAASCLIWVLYGWS
KEPRKDWILIIPNAVGVILGFLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   89

Inward Open:

Template:   4X5M.pdb

Model structure:  F2B915_inward.pdb    Alignment file: F2B915_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.2% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F2B915_outward.pdb    Alignment file: F2B915_out.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.2% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F2B915_occluded.pdb    Alignment file: F2B915_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    8.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur