Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F1Z3Y5

dbSWEET id: dbswt_1762

Accession:   F1Z3Y5

Uniprot status:   Unreviewed

Organism:   Novosphingobium nitrogenifigens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Novosphingobium.

Sequence Information back to top


Sequence length:   103

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|F1Z3Y5|F1Z3Y5_9SPHN|Unreviewed|Novosphingobium nitrogenifigens| 103
MTTENTTTPVAIPTPERRGPSPIDLLGWFASVMAVCMYVSYIAQIQLNLAGQKGSLIQPL
TTVLNCALWSAYGIFKPGRDWPVVLANLPGVALGAVTFTTALP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   27     Model end:   103

Inward Open:

Template:   4X5M.pdb

Model structure:  F1Z3Y5_inward.pdb    Alignment file: F1Z3Y5_inw.pir

Procheck score ⇒ Ramachandran plot: 86.7% favored    10.9% allowed    .8% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F1Z3Y5_outward.pdb    Alignment file: F1Z3Y5_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.0% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F1Z3Y5_occluded.pdb    Alignment file: F1Z3Y5_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.0% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur