| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F1Z3Y5
dbSWEET id: dbswt_1762
Accession: F1Z3Y5
Uniprot status: Unreviewed
Organism: Novosphingobium nitrogenifigens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Novosphingobium.
Sequence Information back to top
Sequence length: 103
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F1Z3Y5|F1Z3Y5_9SPHN|Unreviewed|Novosphingobium nitrogenifigens| 103
MTTENTTTPVAIPTPERRGPSPIDLLGWFASVMAVCMYVSYIAQIQLNLAGQKGSLIQPL
TTVLNCALWSAYGIFKPGRDWPVVLANLPGVALGAVTFTTALP
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: F1Z3Y5_inward.pdb Alignment file: F1Z3Y5_inw.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 10.9% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: F1Z3Y5_outward.pdb Alignment file: F1Z3Y5_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .8% week .0% disallowed Occluded: Model structure: F1Z3Y5_occluded.pdb Alignment file: F1Z3Y5_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA