Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F1RGR5

dbSWEET id: dbswt_1169

Accession:   F1RGR5

Uniprot status:   Unreviewed

Organism:   Sus scrofa

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Suina ⇒ Suidae ⇒ Sus.

Sequence Information back to top


Sequence length:   226

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|F1RGR5|F1RGR5_PIG|Unreviewed|Sus_scrofa|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDANNLGWLSY
GALKGNGTLIVVNAVGAVLQTLYILVYLHYCHRKGAVLLQTATLLVVLVLGFGYFCLLVP
DLETRLQQLGLFCSIFTISMYLSPLADLAKVIQTKSTQRLSFSLTIATLLTSASWTLYGF
RIEDPYIVVPNLPGILTSLIRLWLFWKYPPGARQELSASANLREFI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: F1RGR5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  F1RGR5_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    3.2% allowed    2.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  F1RGR5_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    8.1% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  F1RGR5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.0% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur