| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F1RGR5
dbSWEET id: dbswt_1169
Accession: F1RGR5
Uniprot status: Unreviewed
Organism: Sus scrofa
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Suina ⇒ Suidae ⇒ Sus.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|F1RGR5|F1RGR5_PIG|Unreviewed|Sus_scrofa|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDANNLGWLSY
GALKGNGTLIVVNAVGAVLQTLYILVYLHYCHRKGAVLLQTATLLVVLVLGFGYFCLLVP
DLETRLQQLGLFCSIFTISMYLSPLADLAKVIQTKSTQRLSFSLTIATLLTSASWTLYGF
RIEDPYIVVPNLPGILTSLIRLWLFWKYPPGARQELSASANLREFI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: F1RGR5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: F1RGR5_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.2% allowed 2.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: F1RGR5_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 8.1% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: F1RGR5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.3% favored 7.0% allowed 1.6% week 1.1% disallowed
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA