Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F1LAL5

dbSWEET id: dbswt_1168

Accession:   F1LAL5

Uniprot status:   Unreviewed

Organism:   Ascaris suum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Ascaridida ⇒ Ascaridoidea ⇒ Ascarididae ⇒ Ascaris.

Sequence Information back to top


Sequence length:   224

Substrate Binding Site:   GNWN           CVV:   380       CHI:   -5.6

Selectivity Filter:   LSTV           CVV:   395       CHI:   6.5

Fasta sequence:

>tr|F1LAL5|F1LAL5_ASCSU|Unreviewed|Ascaris_suum|224
MHNADLQTDFIVRIVSSVAAVSTICLFLTGFEICWRIKKHGSTEDIGSAPFHMGFVSGFL
WLHYGILKEDRAVFCVNMVSSSLYTFYLLYYCLRTPYPMKRRQLRFAAIEIIFLSLIHLY
VEYSQHAKEIILDHLGYICVAFNVATVAAPLLALGEVIRSKSTENLPLPLCLANLLVTSE
WLLYGFLVEDFFIKFPNAIAVIISIAQIVPFAIYPRKGENISKH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   216

Alignment file: F1LAL5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  F1LAL5_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    6.8% allowed    2.1% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  F1LAL5_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    5.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  F1LAL5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.7% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur