| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F0T9U2
dbSWEET id: dbswt_2077
Accession: F0T9U2
Uniprot status: Unreviewed
Organism: Methanobacterium lacus
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Euryarchaeota ⇒ Methanobacteria ⇒ Methanobacteriales ⇒ Methanobacteriaceae ⇒ Methanobacterium.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F0T9U2|F0T9U2_METLA|Unreviewed|Methanobacterium lacus|89
MSINAIEVIGSLACLFTFLMYLSTIDQMRTVLKTENSEEVSEILYWVMFFNCFFWSIYGL
YLSNNYILIPNFVGCVLSLTTAAVVWKYR
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: F0T9U2_inward.pdb Alignment file: F0T9U2_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.9% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F0T9U2_outward.pdb Alignment file: F0T9U2_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.9% allowed .7% week .0% disallowed Occluded: Model structure: F0T9U2_occluded.pdb Alignment file: F0T9U2_occ.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 6.9% allowed .7% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA