Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F0T9U2

dbSWEET id: dbswt_2077

Accession:   F0T9U2

Uniprot status:   Unreviewed

Organism:   Methanobacterium lacus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Methanobacteria ⇒ Methanobacteriales ⇒ Methanobacteriaceae ⇒ Methanobacterium.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|F0T9U2|F0T9U2_METLA|Unreviewed|Methanobacterium lacus|89
MSINAIEVIGSLACLFTFLMYLSTIDQMRTVLKTENSEEVSEILYWVMFFNCFFWSIYGL
YLSNNYILIPNFVGCVLSLTTAAVVWKYR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  F0T9U2_inward.pdb    Alignment file: F0T9U2_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.9% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F0T9U2_outward.pdb    Alignment file: F0T9U2_out.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.9% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F0T9U2_occluded.pdb    Alignment file: F0T9U2_occ.pir

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.9% allowed    .7% week    .0% disallowed

Gene Informationback to top


Gene ID:   10278205

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur