Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F0III1

dbSWEET id: dbswt_2009

Accession:   F0III1

Uniprot status:   Unreviewed

Organism:   Capnocytophaga

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|F0III1|F0III1_9FLAO|Unreviewed|Capnocytophaga|89
MENKFIRILGVLAAIMAVAMYVAYIDQIKATWGDATGPWLQPFIAGINCTLWVSYGLFKR
ERDYPIVFANLPGIFLGFFAALTAYSSAF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  F0III1_inward.pdb    Alignment file: F0III1_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F0III1_outward.pdb    Alignment file: F0III1_out.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.5% allowed    3.1% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F0III1_occluded.pdb    Alignment file: F0III1_occ.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    10.2% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur