Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F0H3Y0
dbSWEET id: dbswt_1760
Accession: F0H3Y0
Uniprot status: Unreviewed
Organism: Prevotella denticola
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|F0H3Y0|F0H3Y0_9BACT|Unreviewed|Prevotella denticola|86
MTKEKFFTSMGWVGMVTSILMYIFYFPQIENNLAGHKGTFIQPFMAGINCTLWVCYGLFK
EKRDLPLAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: F0H3Y0_inward.pdb Alignment file: F0H3Y0_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F0H3Y0_outward.pdb Alignment file: F0H3Y0_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 4.8% allowed .0% week 2.4% disallowed Occluded: Model structure: F0H3Y0_occluded.pdb Alignment file: F0H3Y0_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 4.0% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA