Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F0F897
dbSWEET id: dbswt_1759
Accession: F0F897
Uniprot status: Unreviewed
Organism: Prevotella multiformis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|F0F897|F0F897_9BACT|Unreviewed|Prevotella multiformis|86
MTKEKFFTSMGWIGMVTSVLMYIFYFPQIQNNLAGHKGTFIQPFMAGINCTLWVSYGLFK
EKRDWPLAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: F0F897_inward.pdb Alignment file: F0F897_inw.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 4.8% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F0F897_outward.pdb Alignment file: F0F897_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 8.7% allowed .0% week .0% disallowed Occluded: Model structure: F0F897_occluded.pdb Alignment file: F0F897_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 3.2% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA