| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F0F2U0
dbSWEET id: dbswt_1758
Accession: F0F2U0
Uniprot status: Unreviewed
Organism: Kingella denitrificans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Kingella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|F0F2U0|F0F2U0_9NEIS|Unreviewed|Kingella denitrificans|88
MISKKKFNTFIGSIGAAIGIFVFIAYIPQIIANLDGAKAQPWQPLFAAVSCLIWVLYGWS
KEPKKDWILIVPNAVGVILGSLTFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: F0F2U0_inward.pdb Alignment file: F0F2U0_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F0F2U0_outward.pdb Alignment file: F0F2U0_out.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 4.7% allowed .0% week .8% disallowed Occluded: Model structure: F0F2U0_occluded.pdb Alignment file: F0F2U0_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.8% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA