Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E9FY84

dbSWEET id: dbswt_1165

Accession:   E9FY84

Uniprot status:   Unreviewed

Organism:   Daphnia pulex

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Branchiopoda ⇒ Diplostraca ⇒ Cladocera ⇒ Anomopoda ⇒ Daphniidae ⇒ Daphnia.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QGFV           CVV:   402       CHI:   3.1

Fasta sequence:

>tr|E9FY84|E9FY84_DAPPU|Unreviewed|Daphnia_pulex|221
MALENFREILSVTATITTIIQFLTGVIICLSIRRKGGSGDISGFPFIAGVLGCSLWLRYG
MLMKDTAMTVVNAVGLVLQLCYVFMYYLYATNKGPYLKQVVIVFSVILSTMLYVAVEPIE
DKAEFRLGLLCCATTLIFCSAPLATLGDVLRTRSTETLPFYLILANVFVAAQWFLYGVAV
HNTFVQVPNFISCLIALFQLALFAFFPSTNTRTKLQVSDEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: E9FY84.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E9FY84_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    7.0% allowed    3.8% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E9FY84_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.1% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E9FY84_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.7% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur