Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E9FY84
dbSWEET id: dbswt_1165
Accession: E9FY84
Uniprot status: Unreviewed
Organism: Daphnia pulex
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Branchiopoda ⇒ Diplostraca ⇒ Cladocera ⇒ Anomopoda ⇒ Daphniidae ⇒ Daphnia.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QGFV CVV: 402 CHI: 3.1
Fasta sequence:
>tr|E9FY84|E9FY84_DAPPU|Unreviewed|Daphnia_pulex|221
MALENFREILSVTATITTIIQFLTGVIICLSIRRKGGSGDISGFPFIAGVLGCSLWLRYG
MLMKDTAMTVVNAVGLVLQLCYVFMYYLYATNKGPYLKQVVIVFSVILSTMLYVAVEPIE
DKAEFRLGLLCCATTLIFCSAPLATLGDVLRTRSTETLPFYLILANVFVAAQWFLYGVAV
HNTFVQVPNFISCLIALFQLALFAFFPSTNTRTKLQVSDEE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: E9FY84.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E9FY84_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.2% favored 7.0% allowed 3.8% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E9FY84_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 8.1% allowed 2.2% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E9FY84_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 9.7% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA