| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E9FKD9
dbSWEET id: dbswt_1756
Accession: E9FKD9
Uniprot status: Unreviewed
Organism: Streptococcus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|E9FKD9|E9FKD9_9STRE|Unreviewed|Streptococcus|86
MSEKQMNVLGWVTTFMSVMMYVSYFPQIMNNLAGQKGNFIQPLVAAINCSLWVYYGLFKK
ERDIPLAAANAPGIVFGLVTAITALI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: E9FKD9_inward.pdb Alignment file: E9FKD9_inw.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.9% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: E9FKD9_outward.pdb Alignment file: E9FKD9_out.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 4.6% allowed .8% week .0% disallowed Occluded: Model structure: E9FKD9_occluded.pdb Alignment file: E9FKD9_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA