Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E8KBG5
dbSWEET id: dbswt_1753
Accession: E8KBG5
Uniprot status: Unreviewed
Organism: Streptococcus peroris
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|E8KBG5|E8KBG5_9STRE|Unreviewed|Streptococcus peroris|86
MSEKQMKIVGWIATFMSIMMYVSYIPQILDNLAGHKGNFIQPAVAALNCCLWCYYGFFKE
KRDIPIVAANIPGIILGIITALTSIF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: E8KBG5_inward.pdb Alignment file: E8KBG5_inw.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 4.6% allowed .8% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: E8KBG5_outward.pdb Alignment file: E8KBG5_out.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 9.2% allowed .0% week 1.5% disallowed Occluded: Model structure: E8KBG5_occluded.pdb Alignment file: E8KBG5_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.2% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA