| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E8K3G2
dbSWEET id: dbswt_1752
Accession: E8K3G2
Uniprot status: Unreviewed
Organism: Streptococcus parasanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|E8K3G2|E8K3G2_STRPA|Unreviewed|Streptococcus parasanguinis|87
MNKQKINQIVGSIGAFIGIIVFIAYIPQIIANLQGHKAQPFQPLSAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: E8K3G2_inward.pdb Alignment file: E8K3G2_inw.pir Procheck score ⇒ Ramachandran plot: 85.7% favored 11.9% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: E8K3G2_outward.pdb Alignment file: E8K3G2_out.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 7.9% allowed 3.2% week .0% disallowed Occluded: Model structure: E8K3G2_occluded.pdb Alignment file: E8K3G2_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA