Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E8K269

dbSWEET id: dbswt_1751

Accession:   E8K269

Uniprot status:   Unreviewed

Organism:   Streptococcus infantis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|E8K269|E8K269_9STRE|Unreviewed|Streptococcus infantis|87
MTKQRINQVVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAVSCLIWVIYGWTK
EPKKDWILIIPNSAGVVLGGLTFLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  E8K269_inward.pdb    Alignment file: E8K269_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    10.3% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E8K269_outward.pdb    Alignment file: E8K269_out.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    9.5% allowed    1.6% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E8K269_occluded.pdb    Alignment file: E8K269_occ.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur