Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E8K269
dbSWEET id: dbswt_1751
Accession: E8K269
Uniprot status: Unreviewed
Organism: Streptococcus infantis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|E8K269|E8K269_9STRE|Unreviewed|Streptococcus infantis|87
MTKQRINQVVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAVSCLIWVIYGWTK
EPKKDWILIIPNSAGVVLGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: E8K269_inward.pdb Alignment file: E8K269_inw.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 10.3% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: E8K269_outward.pdb Alignment file: E8K269_out.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 9.5% allowed 1.6% week 1.6% disallowed Occluded: Model structure: E8K269_occluded.pdb Alignment file: E8K269_occ.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA