Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E7RT86

dbSWEET id: dbswt_1744

Accession:   E7RT86

Uniprot status:   Unreviewed

Organism:   Prevotella oralis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   99

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|E7RT86|E7RT86_9BACT|Unreviewed|Prevotella oralis|99
MQAITKTKSNIDFMDRSKFFEKLGWLGMATSVMMYIFYFPQISLNLQGHKGPFIQPLMAG
INCTLWVCYGLFKEKRDLPLALANAPGVLFGFFAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   24     Model end:   100

Inward Open:

Template:   4X5M.pdb

Model structure:  E7RT86_inward.pdb    Alignment file: E7RT86_inw.pir

Procheck score ⇒ Ramachandran plot: 83.9% favored    13.7% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E7RT86_outward.pdb    Alignment file: E7RT86_out.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    12.9% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E7RT86_occluded.pdb    Alignment file: E7RT86_occ.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur