Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E7N163

dbSWEET id: dbswt_1743

Accession:   E7N163

Uniprot status:   Unreviewed

Organism:   Selenomonas artemidis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.

Sequence Information back to top


Sequence length:   111

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E7N163|E7N163_9FIRM|Unreviewed|Selenomonas artemidis| 111
MEEVLKKAEAEAEHLEEKAVQIGVEAAKNKMSIVGVIASGLSICMYVSYIPQIIGNLSGH
QGDWIQPSVAFINCTIWVGYGFFKEQRDWPIVFANLPGIIFGLTAAITARL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   111

Inward Open:

Template:   4X5M.pdb

Model structure:  E7N163_inward.pdb    Alignment file: E7N163_inw.pir

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.6% allowed    3.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E7N163_outward.pdb    Alignment file: E7N163_out.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E7N163_occluded.pdb    Alignment file: E7N163_occ.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    3.2% allowed    2.4% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur