Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E7MMD3

dbSWEET id: dbswt_1742

Accession:   E7MMD3

Uniprot status:   Unreviewed

Organism:   Solobacterium moorei

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Erysipelotrichia ⇒ Erysipelotrichales ⇒ Erysipelotrichaceae ⇒ Solobacterium.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TSTS           CVV:   332       CHI:   -3

Fasta sequence:

>tr|E7MMD3|E7MMD3_9FIRM|Unreviewed|Solobacterium moorei|86
MKKKINTIVGSIGAFVGIFVFITYIPQIIANLNGIKGQPQQPLTAAVSCLIWVIYGWTKE
PKKDYILIIPNTFGVVLGFLTFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  E7MMD3_inward.pdb    Alignment file: E7MMD3_inw.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.6% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E7MMD3_outward.pdb    Alignment file: E7MMD3_out.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.0% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E7MMD3_occluded.pdb    Alignment file: E7MMD3_occ.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    5.6% allowed    4.8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur