Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E6LSA6

dbSWEET id: dbswt_1739

Accession:   E6LSA6

Uniprot status:   Unreviewed

Organism:   Lachnoanaerobaculum saburreum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Lachnoanaerobaculum.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E6LSA6|E6LSA6_9FIRM|Unreviewed|Lachnoanaerobaculum saburreum|94
MALDMRGINMSEKNLEIMGWIGTALSVIMYISYVPQIVGNLHGHKTFFLQPLAATINCSI
WTVYGLLLEKRDYPLSAANLPGVIFGLIATITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   19     Model end:   95

Inward Open:

Template:   4X5M.pdb

Model structure:  E6LSA6_inward.pdb    Alignment file: E6LSA6_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.9% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E6LSA6_outward.pdb    Alignment file: E6LSA6_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E6LSA6_occluded.pdb    Alignment file: E6LSA6_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.8% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur