Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E6LJZ4

dbSWEET id: dbswt_1738

Accession:   E6LJZ4

Uniprot status:   Unreviewed

Organism:   Lachnoanaerobaculum saburreum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Lachnoanaerobaculum.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SSSS           CVV:   292       CHI:   -3.2

Fasta sequence:

>tr|E6LJZ4|E6LJZ4_9FIRM|Unreviewed|Lachnoanaerobaculum saburreum|87
MSKKKINTFIGSIGAFIGVLVFLSYIPQIIANIGGAKSQPLQPLVAAVSCLLWVIYGLTN
EYKIDYILIIPNAAGVVFGFLTFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  E6LJZ4_inward.pdb    Alignment file: E6LJZ4_inw.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.2% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E6LJZ4_outward.pdb    Alignment file: E6LJZ4_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.2% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E6LJZ4_occluded.pdb    Alignment file: E6LJZ4_occ.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    8.6% allowed    1.6% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur