Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E6K4Z0
dbSWEET id: dbswt_1737
Accession: E6K4Z0
Uniprot status: Unreviewed
Organism: Prevotella buccae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|E6K4Z0|E6K4Z0_9BACT|Unreviewed|Prevotella buccae|86
MTKEKFFGTMGWVGMATSVLMYVFYFPQIQNNLEGHKGTFIQPFMAGINCTLWVAYGLFK
EKRDLPLAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: E6K4Z0_inward.pdb Alignment file: E6K4Z0_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 10.3% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: E6K4Z0_outward.pdb Alignment file: E6K4Z0_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Occluded: Model structure: E6K4Z0_occluded.pdb Alignment file: E6K4Z0_occ.pir Procheck score ⇒ Ramachandran plot: 96.8% favored 2.4% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA