Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E5UL97

dbSWEET id: dbswt_1735

Accession:   E5UL97

Uniprot status:   Unreviewed

Organism:   Neisseria mucosa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Neisseria.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E5UL97|E5UL97_NEIMU|Unreviewed|Neisseria mucosa|85
MTEKQMRILSVVATLAAVGMYVSYIPQIQNNLAGNPGSPLQPLVAAINCTLWFAYGFLKE
KRDYPIILANAPGIILGLITFVTSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  E5UL97_inward.pdb    Alignment file: E5UL97_inw.pir

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.6% allowed    3.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E5UL97_outward.pdb    Alignment file: E5UL97_out.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    11.3% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E5UL97_occluded.pdb    Alignment file: E5UL97_occ.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    .8% week    .8% disallowed

Gene Informationback to top


Gene ID:   25048157

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur