Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E4LC27

dbSWEET id: dbswt_1732

Accession:   E4LC27

Uniprot status:   Unreviewed

Organism:   Veillonella

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E4LC27|E4LC27_9FIRM|Unreviewed|Veillonella|88
MNQVKFMENLGKVATVTAVAMYVSYFPQIMNNLAHPGTGDWIQPLVAAINCTLWVLYGLF
KEHRDIPVALANAPGIFFGLAAAITALM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  E4LC27_inward.pdb    Alignment file: E4LC27_inw.pir

Procheck score ⇒ Ramachandran plot: 96.9% favored    3.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E4LC27_outward.pdb    Alignment file: E4LC27_out.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.4% allowed    3.1% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E4LC27_occluded.pdb    Alignment file: E4LC27_occ.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.7% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur