| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E4LBW9
dbSWEET id: dbswt_1731
Accession: E4LBW9
Uniprot status: Unreviewed
Organism: Veillonella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|E4LBW9|E4LBW9_9FIRM|Unreviewed|Veillonella|87
MTKERFNMLVGSIGAFIGVFVFLAYIPQIIANLHGQPSQPWQPLFAAVSCLIWVLYGWTK
SPKRDYILIVPNLAGVVLGTLTFLTSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: E4LBW9_inward.pdb Alignment file: E4LBW9_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: E4LBW9_outward.pdb Alignment file: E4LBW9_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.8% allowed .8% week .0% disallowed Occluded: Model structure: E4LBW9_occluded.pdb Alignment file: E4LBW9_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA