Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E3NMJ0

dbSWEET id: dbswt_1163

Accession:   E3NMJ0

Uniprot status:   Unreviewed

Organism:   Caenorhabditis remanei

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   272

Substrate Binding Site:   GTWN           CVV:   400       CHI:   -5.5

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|E3NMJ0|E3NMJ0_CAERE|Unreviewed|Caenorhabditis_remanei|272
MFEIFTQGFSFLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLWITLKVLGVIGICTSLVLGVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSTEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFIVLPRKPGQRAPIVRLWLWIRGVKVEETKEIVAE
LGECDEKKMNRAQRWSQKIKMNVSTVAENWRM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: E3NMJ0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E3NMJ0_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.7% favored    9.6% allowed    1.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E3NMJ0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.9% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E3NMJ0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.1% favored    10.2% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Gene ID:   9823217     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur