Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E3NMJ0
dbSWEET id: dbswt_1163
Accession: E3NMJ0
Uniprot status: Unreviewed
Organism: Caenorhabditis remanei
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 272
Substrate Binding Site: GTWN CVV: 400 CHI: -5.5
Selectivity Filter: LGDV CVV: 368 CHI: 4.1
Fasta sequence:
>tr|E3NMJ0|E3NMJ0_CAERE|Unreviewed|Caenorhabditis_remanei|272
MFEIFTQGFSFLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLWITLKVLGVIGICTSLVLGVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSTEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFIVLPRKPGQRAPIVRLWLWIRGVKVEETKEIVAE
LGECDEKKMNRAQRWSQKIKMNVSTVAENWRM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 211
Alignment file: E3NMJ0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E3NMJ0_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.7% favored 9.6% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E3NMJ0_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.9% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E3NMJ0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.1% favored 10.2% allowed 1.7% week .0% disallowed
Gene Informationback to top
Gene ID: 9823217 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA