Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E3ND04
dbSWEET id: dbswt_1162
Accession: E3ND04
Uniprot status: Unreviewed
Organism: Caenorhabditis remanei
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 282
Substrate Binding Site: SQAN CVV: 350 CHI: -6
Selectivity Filter: LGGM CVV: 344 CHI: 4.9
Fasta sequence:
>tr|E3ND04|E3ND04_CAERE|Unreviewed|Caenorhabditis_remanei|282
MVFRCDAKIVVASKSLSTSLHFLLASFLIILSIFLFSTCYFFQKMELDLGTISVSRLFAM
YTSNLVWSLFLTSTALHAVALITSPVQAVYKWIRRQSSDSDTPIPYICAVIGSSLWLRYS
IFLRDTKLILLQTYAVSMQLFFVVALIFYRTKRRKLIRLMTGIAAAMSLLFLYIDNLNDE
DGKEFTGRIASGAQIAGSLVCPYLIYKAVTSKCIDFVPLAPVVFTWVMELHAIVYSIGID
DFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKNLKSPIPTVM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 60 Model end: 267
Alignment file: E3ND04.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E3ND04_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.2% allowed 2.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E3ND04_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 8.4% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E3ND04_occluded.pdb
Procheck score ⇒ Ramachandran plot: 85.3% favored 13.1% allowed 1.0% week .5% disallowed
Gene Informationback to top
Gene ID: 9823097 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA