Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E3ND04

dbSWEET id: dbswt_1162

Accession:   E3ND04

Uniprot status:   Unreviewed

Organism:   Caenorhabditis remanei

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   282

Substrate Binding Site:   SQAN           CVV:   350       CHI:   -6

Selectivity Filter:   LGGM           CVV:   344       CHI:   4.9

Fasta sequence:

>tr|E3ND04|E3ND04_CAERE|Unreviewed|Caenorhabditis_remanei|282
MVFRCDAKIVVASKSLSTSLHFLLASFLIILSIFLFSTCYFFQKMELDLGTISVSRLFAM
YTSNLVWSLFLTSTALHAVALITSPVQAVYKWIRRQSSDSDTPIPYICAVIGSSLWLRYS
IFLRDTKLILLQTYAVSMQLFFVVALIFYRTKRRKLIRLMTGIAAAMSLLFLYIDNLNDE
DGKEFTGRIASGAQIAGSLVCPYLIYKAVTSKCIDFVPLAPVVFTWVMELHAIVYSIGID
DFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKNLKSPIPTVM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   60     Model end:   267

Alignment file: E3ND04.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E3ND04_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.2% allowed    2.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E3ND04_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    8.4% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E3ND04_occluded.pdb

Procheck score ⇒ Ramachandran plot: 85.3% favored    13.1% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Gene ID:   9823097     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur