| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E3M0K8
dbSWEET id: dbswt_1161
Accession: E3M0K8
Uniprot status: Unreviewed
Organism: Caenorhabditis remanei
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 222
Substrate Binding Site: QNWN CVV: 469 CHI: -11.4
Selectivity Filter: FIGL CVV: 431 CHI: 10.7
Fasta sequence:
>tr|E3M0K8|E3M0K8_CAERE|Unreviewed|Caenorhabditis_remanei|222
MFLKLYTVWLGVFSVSFVFLPIYLVLNWRKRGTADGFSSVVLIIPMIIQSFWLRHGLMTN
DWTNIIINSLNLSVLSCYVAAYAYYQPKRKYLIGQIIGAAVIIKCAFLYVDSHDSEHVNA
AMGSVAAGAQILGLGGRLYEMRRAIKMGTTEYIPAVMQFAVTALMAQWFIFGVITGNKFI
AIANIAGLITSAFTVMLYFRYPPLTWTVPIFNIPPQQSQKQE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: E3M0K8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E3M0K8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 5.5% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E3M0K8_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 5.5% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E3M0K8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 7.2% allowed .6% week .0% disallowed
Gene Informationback to top
Gene ID: 9825495 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018175: SWEET_nem. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF4: