Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E3M0K8

dbSWEET id: dbswt_1161

Accession:   E3M0K8

Uniprot status:   Unreviewed

Organism:   Caenorhabditis remanei

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   QNWN           CVV:   469       CHI:   -11.4

Selectivity Filter:   FIGL           CVV:   431       CHI:   10.7

Fasta sequence:

>tr|E3M0K8|E3M0K8_CAERE|Unreviewed|Caenorhabditis_remanei|222
MFLKLYTVWLGVFSVSFVFLPIYLVLNWRKRGTADGFSSVVLIIPMIIQSFWLRHGLMTN
DWTNIIINSLNLSVLSCYVAAYAYYQPKRKYLIGQIIGAAVIIKCAFLYVDSHDSEHVNA
AMGSVAAGAQILGLGGRLYEMRRAIKMGTTEYIPAVMQFAVTALMAQWFIFGVITGNKFI
AIANIAGLITSAFTVMLYFRYPPLTWTVPIFNIPPQQSQKQE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: E3M0K8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E3M0K8_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.5% allowed    .6% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E3M0K8_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.9% favored    5.5% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E3M0K8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.2% allowed    .6% week    .0% disallowed

Gene Informationback to top


Gene ID:   9825495     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018175: SWEET_nem. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF4:

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur