Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E3LZF4

dbSWEET id: dbswt_1160

Accession:   E3LZF4

Uniprot status:   Unreviewed

Organism:   Caenorhabditis remanei

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   224

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   FSSV           CVV:   386       CHI:   5.4

Fasta sequence:

>tr|E3LZF4|E3LZF4_CAERE|Unreviewed|Caenorhabditis_remanei|224
MTSLGQTILPYLSFTALSSTVAFFLCGLQICHRIKTRGSSEGTSPAPFLLSFLSCGLFIQ
YGLLKDDDIITYTNGIGCFLQGCYLLYFYKLTRNRKFLNKVIAIEMCIIGIVVYWVRHSS
NSHLTKQTYVGNYCIFLNICSVAAPLFDIGKVVRNKSSESLPLPLCIACFVVCFQWMFYG
YIVDDIVILVPNVIATIISILQLSLFIIYPGSPKGVFPEKYEHI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   211

Alignment file: E3LZF4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E3LZF4_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.4% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E3LZF4_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.0% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E3LZF4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   9826008     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur