| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E3LZF4
dbSWEET id: dbswt_1160
Accession: E3LZF4
Uniprot status: Unreviewed
Organism: Caenorhabditis remanei
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 224
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: FSSV CVV: 386 CHI: 5.4
Fasta sequence:
>tr|E3LZF4|E3LZF4_CAERE|Unreviewed|Caenorhabditis_remanei|224
MTSLGQTILPYLSFTALSSTVAFFLCGLQICHRIKTRGSSEGTSPAPFLLSFLSCGLFIQ
YGLLKDDDIITYTNGIGCFLQGCYLLYFYKLTRNRKFLNKVIAIEMCIIGIVVYWVRHSS
NSHLTKQTYVGNYCIFLNICSVAAPLFDIGKVVRNKSSESLPLPLCIACFVVCFQWMFYG
YIVDDIVILVPNVIATIISILQLSLFIIYPGSPKGVFPEKYEHI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 211
Alignment file: E3LZF4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E3LZF4_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E3LZF4_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 7.0% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E3LZF4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 9826008 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA