| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E2ZBX2
dbSWEET id: dbswt_1730
Accession: E2ZBX2
Uniprot status: Unreviewed
Organism: Megasphaera micronuciformis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Megasphaera.
Sequence Information back to top
Sequence length: 100
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|E2ZBX2|E2ZBX2_9FIRM|Unreviewed|Megasphaera micronuciformis| 100
MIYRNRINGKEKQMTKQKLNLLVGSIGAFIGIFVFIAYIPQIYANLQGSKAQPFQPLFAA
ISCLIWVIYGWTKEPKKDWILIIPNSAGVILGGLTFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 24 Model end: 101 Inward Open: Template: 4X5M.pdb Model structure: E2ZBX2_inward.pdb Alignment file: E2ZBX2_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 9.5% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: E2ZBX2_outward.pdb Alignment file: E2ZBX2_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed 2.4% week .0% disallowed Occluded: Model structure: E2ZBX2_occluded.pdb Alignment file: E2ZBX2_occ.pir Procheck score ⇒ Ramachandran plot: 84.9% favored 10.3% allowed 4.0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA