| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E2QRS1
dbSWEET id: dbswt_1158
Accession: E2QRS1
Uniprot status: Unreviewed
Organism: Canis lupus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Carnivora ⇒ Caniformia ⇒ Canidae ⇒ Canis.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|E2QRS1|E2QRS1_CANLF|Unreviewed|Canis_lupus|221
MEPGGVADSLLSGACVLFTLAMYSTGLSDLRHMRMTRSVDNVQFLPFLTTDINNLSWLSY
GALKGDGILIFVNATGAVLQTLYILVYVHYCPRKRPVLLQTATLVGVLLLGFGYFWLLVP
NLETQLQQLGLFCSGFTISMYLSPLADLAKIIQMKSTQRLSFPLTIATLLTSASWTLYGF
QLGDPYIMVPNLPGILTSLVRLWLFWKYSQGPDRNYQLLQT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: E2QRS1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E2QRS1_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 7.2% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E2QRS1_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 8.3% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E2QRS1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 6.1% allowed 1.7% week 1.1% disallowed
Gene Informationback to top
Gene ID: 480132 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA