Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E2PC66

dbSWEET id: dbswt_1729

Accession:   E2PC66

Uniprot status:   Unreviewed

Organism:   Neisseria polysaccharea

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Neisseria.

Sequence Information back to top


Sequence length:   80

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E2PC66|E2PC66_NEIPO|Unreviewed|Neisseria polysaccharea|80
MRILSAAATLTAVGMYVSYIPQIQNNLAGNPGSPLQPLVAAINCTLWVAYGFLKEKRDYP
VILANTPGIILGLITFITSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  E2PC66_inward.pdb    Alignment file: E2PC66_inw.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E2PC66_outward.pdb    Alignment file: E2PC66_out.pir

Procheck score ⇒ Ramachandran plot: 88.7% favored    10.5% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E2PC66_occluded.pdb    Alignment file: E2PC66_occ.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    7.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur