Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E2A1M7

dbSWEET id: dbswt_1156

Accession:   E2A1M7

Uniprot status:   Unreviewed

Organism:   Camponotus floridanus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Vespoidea ⇒ Formicidae ⇒ Formicinae ⇒ Camponotus.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|E2A1M7|E2A1M7_CAMFO|Unreviewed|Camponotus_floridanus|222
MVLEQYKEIVGSCAMYTTMAQMLAGTVICKDIYKKGTTKGVDPMPFLGGIGLCILMLRYA
LMLNDSTMINVNIFGLSTNIIYMIVYYYYAPNTGEVLTLIFKTTIFVLIFLVYAQIEHPE
NVEFRFGLVVTILLLLLIASPLMHLKQIIKTKNTEILPFPLIFMGTLVSFQWLLYGLIIN
NVFIIFQNAVGFILSIAQLSLFVIFPSKNSRAALLSKERKED

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: E2A1M7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E2A1M7_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.5% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E2A1M7_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.5% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E2A1M7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.8% allowed    .0% week    .5% disallowed

Gene Informationback to top


Gene ID:   105259305     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur