| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E1ZHC0
dbSWEET id: dbswt_763
Accession: E1ZHC0
Uniprot status: Unreviewed
Organism: Chlorella variabilis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Trebouxiophyceae ⇒ Chlorellales ⇒ Chlorellaceae ⇒ Chlorella.
Sequence Information back to top
Sequence length: 266
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNFN CVV: 451 CHI: -0.4
Fasta sequence:
>tr|E1ZHC0|E1ZHC0_CHLVA|Unreviewed|Chlorella_variabilis|266
MAVWWQTLVAALGGVVGLILFLSPGKAVLRARSERVLGDLNPLPFPAIAANCAGWIAYSY
VTSDVLVLWPNAAGFLLGMFYTMSAYGLADTKTRDRQIAIMLLFSAVIIVVGSVGTLGHM
SQHGLKTLWGFTSNAILLIFYASPLSTVLEVVRSRSSATLNLPLSVMNVINGTLWLVYGL
AISDLFIAVPNGVGAALGIVYCALLCVFPHKAAKRSPPNSDSNTTSSRRELMVDGGATVS
GDHELGLAAAAVDADGAGGPAGASRV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: E1ZHC0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E1ZHC0_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.1% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E1ZHC0_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E1ZHC0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 5.6% allowed 1.7% week .0% disallowed
Gene Informationback to top
Gene ID: 17354345 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number







Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA