Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E1ZHC0

dbSWEET id: dbswt_763

Accession:   E1ZHC0

Uniprot status:   Unreviewed

Organism:   Chlorella variabilis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Trebouxiophyceae ⇒ Chlorellales ⇒ Chlorellaceae ⇒ Chlorella.

Sequence Information back to top


Sequence length:   266

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNFN           CVV:   451       CHI:   -0.4

Fasta sequence:

>tr|E1ZHC0|E1ZHC0_CHLVA|Unreviewed|Chlorella_variabilis|266
MAVWWQTLVAALGGVVGLILFLSPGKAVLRARSERVLGDLNPLPFPAIAANCAGWIAYSY
VTSDVLVLWPNAAGFLLGMFYTMSAYGLADTKTRDRQIAIMLLFSAVIIVVGSVGTLGHM
SQHGLKTLWGFTSNAILLIFYASPLSTVLEVVRSRSSATLNLPLSVMNVINGTLWLVYGL
AISDLFIAVPNGVGAALGIVYCALLCVFPHKAAKRSPPNSDSNTTSSRRELMVDGGATVS
GDHELGLAAAAVDADGAGGPAGASRV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: E1ZHC0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E1ZHC0_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.1% allowed    1.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E1ZHC0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E1ZHC0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    5.6% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Gene ID:   17354345     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur