| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E1WX46
dbSWEET id: dbswt_1727
Accession: E1WX46
Uniprot status: Unreviewed
Organism: Halobacteriovorax marinus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Deltaproteobacteria ⇒ Bdellovibrionales ⇒ Halobacteriovoraceae ⇒ Halobacteriovorax.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: QSQS CVV: 374 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|E1WX46|E1WX46_HALMS|Unreviewed|Halobacteriovorax marinus|92
MNYIDFSRYVVTFSSILLIIGLYHQVYKMFTTKSADDFSMLMILSLICCQVTWINYGIVL
DEWPILLLSSIELPAGALAFYGYLKFRTKHVL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 8 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: E1WX46_inward.pdb Alignment file: E1WX46_inw.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 2.9% allowed 2.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: E1WX46_outward.pdb Alignment file: E1WX46_out.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 4.3% allowed 1.4% week .0% disallowed Occluded: Model structure: E1WX46_occluded.pdb Alignment file: E1WX46_occ.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 7.2% allowed .7% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA