Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E1W5T5
dbSWEET id: dbswt_1726
Accession: E1W5T5
Uniprot status: Unreviewed
Organism: Haemophilus parainfluenzae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Pasteurellales ⇒ Pasteurellaceae ⇒ Haemophilus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|E1W5T5|E1W5T5_HAEP3|Unreviewed|Haemophilus parainfluenzae|86
MTNQRFITILGYVATFTSVCMYVSYLQQIGLNLSGQKGGWLQPFATMINCSLWVVYGLLK
EKRDLPISLANAPGVILGLITFVTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 8 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: E1W5T5_inward.pdb Alignment file: E1W5T5_inw.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.8% allowed .0% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: E1W5T5_outward.pdb Alignment file: E1W5T5_out.pir Procheck score ⇒ Ramachandran plot: 84.8% favored 12.1% allowed 1.5% week 1.5% disallowed Occluded: Model structure: E1W5T5_occluded.pdb Alignment file: E1W5T5_occ.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 6.8% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA