| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E1G905
dbSWEET id: dbswt_1154
Accession: E1G905
Uniprot status: Unreviewed
Organism: Loa loa
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Loa.
Sequence Information back to top
Sequence length: 223
Substrate Binding Site: MNWN CVV: 479 CHI: -6
Selectivity Filter: FMSL CVV: 456 CHI: 7.7
Fasta sequence:
>tr|E1G905|E1G905_LOALO|Unreviewed|Loa_loa|223
MVALLSIFAIWLTFFSICFTFLPMLQVLDWRKRGTADGFSSINLVLPVLMMGCWLRHGYM
TNDFTNIFINTINLIVFAGYILAFAFYQPCRRYLCLQLFALFFTLFCIFSYVSWQPNDIA
SDVMGSIAAAMQIISLGGQIYEIKRATSFGHTEFIPAELQFGIFFLTIQWTVFGILIENY
YIAIANFAGLLVNIATISLYFIYPPLTWKVPIIGTGPQQEKTE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: E1G905.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E1G905_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.7% favored 8.6% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E1G905_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 7.0% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E1G905_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 5.9% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 9947081 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA