| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : E1BK22
dbSWEET id: dbswt_1152
Accession: E1BK22
Uniprot status: Unreviewed
Organism: Bos taurus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Ruminantia ⇒ Pecora ⇒ Bovidae ⇒ Bovinae ⇒ Bos.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|E1BK22|E1BK22_BOVIN|Unreviewed|Bos_taurus|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDVNNLSWLSY
GALKGNWTLIIVNAVGAVLQTLYILVYLHYCHRKRAVLLQTTTLLGVLVLGFAYFWLLVP
DPEMRLQHLGLFCSVFTISMYLSPLADLAKVIRTKSTQRLSFSLTIATLLTSASWTLYGF
RLRDPYIVVPNLPGILTSFIRFWLFWKYSPGTRQELSASTNLREFT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: E1BK22.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E1BK22_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.2% favored 8.6% allowed 2.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E1BK22_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 7.5% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E1BK22_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.8% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA