Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E1BK22

dbSWEET id: dbswt_1152

Accession:   E1BK22

Uniprot status:   Unreviewed

Organism:   Bos taurus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Cetartiodactyla ⇒ Ruminantia ⇒ Pecora ⇒ Bovidae ⇒ Bovinae ⇒ Bos.

Sequence Information back to top


Sequence length:   226

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|E1BK22|E1BK22_BOVIN|Unreviewed|Bos_taurus|226
MEAGGLADSLLSGACVLFTLGMFSTGLSDLKHMRMTRSVDSVQFLPFLTTDVNNLSWLSY
GALKGNWTLIIVNAVGAVLQTLYILVYLHYCHRKRAVLLQTTTLLGVLVLGFAYFWLLVP
DPEMRLQHLGLFCSVFTISMYLSPLADLAKVIRTKSTQRLSFSLTIATLLTSASWTLYGF
RLRDPYIVVPNLPGILTSFIRFWLFWKYSPGTRQELSASTNLREFT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: E1BK22.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E1BK22_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    8.6% allowed    2.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E1BK22_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    7.5% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E1BK22_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur