Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E0VT83

dbSWEET id: dbswt_1151

Accession:   E0VT83

Uniprot status:   Unreviewed

Organism:   Pediculus humanus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Phthiraptera ⇒ Anoplura ⇒ Pediculidae ⇒ Pediculus.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|E0VT83|E0VT83_PEDHC|Unreviewed|Pediculus_humanus|221
MKNTDVLYWRDILGTSASIWTILQMLSPVPTCYYFIRKKTVGDMIVTPYAVALTSCTLWL
IYGIIINDYTIVKVNTIGATLQFSYTFCYYIHCTKKNDVRKQLGIGFLTIVTAFFYSMNE
KNMSRLVTVFGLLCSIVTVLFFVSPLANMRYVIRVWNSESLPRLLIATTFIVSLQWFLYG
YITNDGYIMITNFLGTLLSSLQLAMMFIIPRDSSVKYVSTV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   211

Alignment file: E0VT83.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E0VT83_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.2% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E0VT83_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.4% allowed    1.0% week    1.0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E0VT83_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    8.4% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur