Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E0VT83
dbSWEET id: dbswt_1151
Accession: E0VT83
Uniprot status: Unreviewed
Organism: Pediculus humanus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Phthiraptera ⇒ Anoplura ⇒ Pediculidae ⇒ Pediculus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|E0VT83|E0VT83_PEDHC|Unreviewed|Pediculus_humanus|221
MKNTDVLYWRDILGTSASIWTILQMLSPVPTCYYFIRKKTVGDMIVTPYAVALTSCTLWL
IYGIIINDYTIVKVNTIGATLQFSYTFCYYIHCTKKNDVRKQLGIGFLTIVTAFFYSMNE
KNMSRLVTVFGLLCSIVTVLFFVSPLANMRYVIRVWNSESLPRLLIATTFIVSLQWFLYG
YITNDGYIMITNFLGTLLSSLQLAMMFIIPRDSSVKYVSTV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 211
Alignment file: E0VT83.pir
Inward Open:
Template: 5CTG.pdb
Model structure: E0VT83_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.2% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: E0VT83_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.5% favored 9.4% allowed 1.0% week 1.0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: E0VT83_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.1% favored 8.4% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA