Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E0QI16

dbSWEET id: dbswt_1724

Accession:   E0QI16

Uniprot status:   Unreviewed

Organism:   Eubacterium yurii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Peptostreptococcaceae ⇒ Peptoclostridium.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|E0QI16|E0QI16_9FIRM|Unreviewed|Eubacterium yurii|85
MNEKTVKIMGWVATCTAMLMYVAYFPQIVNNLHGHKTGFLQPLVAAINCTLWVCYGFFQK
KKEWPIVVANLPGVIFGAIAAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  E0QI16_inward.pdb    Alignment file: E0QI16_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.2% allowed    1.5% week    1.5% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E0QI16_outward.pdb    Alignment file: E0QI16_out.pir

Procheck score ⇒ Ramachandran plot: 88.5% favored    10.8% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E0QI16_occluded.pdb    Alignment file: E0QI16_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur