Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E0P055
dbSWEET id: dbswt_1721
Accession: E0P055
Uniprot status: Unreviewed
Organism: Selenomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: TSTS CVV: 332 CHI: -3
Fasta sequence:
>tr|E0P055|E0P055_9FIRM|Unreviewed|Selenomonas|87
MKKKKINLIVGSIGAFIGVFVFITYIPQIIANLEGVKAQPWQPLTASISCLIWVIYGWTK
EPKKDFILIVPNLAGVILGFLTFVTAI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: E0P055_inward.pdb Alignment file: E0P055_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 9.5% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: E0P055_outward.pdb Alignment file: E0P055_out.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 8.7% allowed 1.6% week .8% disallowed Occluded: Model structure: E0P055_occluded.pdb Alignment file: E0P055_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA