Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : E0NTM3
dbSWEET id: dbswt_1720
Accession: E0NTM3
Uniprot status: Unreviewed
Organism: Prevotella marshii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|E0NTM3|E0NTM3_9BACT|Unreviewed|Prevotella marshii|86
MKKEKFFETLGWIGMVTSILMYVFYFPQILQNLGGHKGTFIQPFMAGINCTLWVGYGLFK
ERRDWPVTIANLPGIVFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: E0NTM3_inward.pdb Alignment file: E0NTM3_inw.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 8.2% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: E0NTM3_outward.pdb Alignment file: E0NTM3_out.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 6.6% allowed .0% week .8% disallowed Occluded: Model structure: E0NTM3_occluded.pdb Alignment file: E0NTM3_occ.pir Procheck score ⇒ Ramachandran plot: 94.3% favored 4.9% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA