Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E0E4R3

dbSWEET id: dbswt_1718

Accession:   E0E4R3

Uniprot status:   Unreviewed

Organism:   Peptostreptococcus stomatis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Peptostreptococcaceae ⇒ Peptostreptococcus.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|E0E4R3|E0E4R3_9FIRM|Unreviewed|Peptostreptococcus stomatis|85
MSQKTFRILGWIATCTAMLMYISYFPQIINNIHGNKSGFLQPMVAAINCTLWVSYGFFQD
KKDWPIVIANVPGVIFGTVAAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  E0E4R3_inward.pdb    Alignment file: E0E4R3_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    6.2% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  E0E4R3_outward.pdb    Alignment file: E0E4R3_out.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    9.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  E0E4R3_occluded.pdb    Alignment file: E0E4R3_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur