Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : E0CS05

dbSWEET id: dbswt_623

Accession:   E0CS05

Uniprot status:   Unreviewed

Organism:   Vitis vinifera

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.

Sequence Information back to top


Sequence length:   235

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|E0CS05|E0CS05_VITVI|Unreviewed|Vitis_vinifera|235
MSRSLLLPVNTICKDAAGVAGNIFAFGLFVSPIPTFRRIARNRSTESFSGLPYIYALLNC
LVTLWYGTPLVSYNNIMVTTVNSMGAAFQLVYIILFITYTDKRKKVRMFGLLMVDIVLFL
VIVVGSLEISDFTIRRMVVGFLSCAALISMFASPLFVINLVIQTRSVEFMPFYLSLSTFL
MSASFLAYGILNNDPFVYVPNGAGTVLGIVQLGLYSYYKRTSAEESREPLIVSYG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: E0CS05.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  E0CS05_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    2.7% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  E0CS05_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.8% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  E0CS05_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   100255517     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur