Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D8TZF0
dbSWEET id: dbswt_767
Accession: D8TZF0
Uniprot status: Unreviewed
Organism: Volvox carteri
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Chlorophyceae ⇒ Chlamydomonadales ⇒ Volvocaceae ⇒ Volvox.
Sequence Information back to top
Sequence length: 315
Substrate Binding Site: AIWN CVV: 450 CHI: 1.9
Selectivity Filter: MNYN CVV: 457 CHI: -6.4
Fasta sequence:
>tr|D8TZF0|D8TZF0_VOLCA|Unreviewed|Volvox_carteri|315
MGAFTETAVPIFGNILATAMLLSPFPAVLRLRQTGKLMDINPLPYPMTCINAAGWVAYGY
AVANPYIFPANIIGFLAGMFFTLTAFSCAPQKLQDLITGLLVAGSGYFIMLGLISCFGLA
QTESQRMWGISAVAILMCYYFVPLSTMVSIVRTRNAASIYPPLAATAIANGSMWTIYGLA
VKDINLWLPNMFGAVIGAVQLILRLVYGARSVGDAPAVTVADEEAFVVVHKGAGAPVEDR
MDSGTNLLRPGHVRSSGQGATGPTGPGGAAEPTANSGATSRHWSDDASAASPASPSDPGQ
SGTAQPAGGPLTAAP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: D8TZF0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D8TZF0_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.2% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D8TZF0_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D8TZF0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.1% allowed .6% week .6% disallowed
Gene Informationback to top
Gene ID: 9615898 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA