Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D8TI60

dbSWEET id: dbswt_764

Accession:   D8TI60

Uniprot status:   Unreviewed

Organism:   Volvox carteri

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Chlorophyceae ⇒ Chlamydomonadales ⇒ Volvocaceae ⇒ Volvox.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNYN           CVV:   457       CHI:   -6.4

Fasta sequence:

>tr|D8TI60|D8TI60_VOLCA|Unreviewed|Volvox_carteri|250
MAMRRLLDDHDDMDFKEVLLKHIAPGLGCIIAFLMFVSPLKAVLQVRASKHLGDLNPLPL
VAIIANCAAWLLYGCINADPYVILANEPGLLLGVFMTVSSYGFADPRARDLMLKALLFFT
VIISGAGITIALFVERDHTASLISGYTAVFVLLCYYGAPLSTISEVVRSRSSASLFWPIS
VMNTVNGLLWVAYGTAVEDLFIAVPNAIGATFGLIQLVLIQCYPAKKAVVAVGGDRGDSD
PLLQDSKHVA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   225

Alignment file: D8TI60.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D8TI60_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.9% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D8TI60_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    6.5% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D8TI60_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   9625361     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur