Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D8TCK3
dbSWEET id: dbswt_771
Accession: D8TCK3
Uniprot status: Unreviewed
Organism: Selaginella moellendorffii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|D8TCK3|D8TCK3_SELML|Unreviewed|Selaginella_moellendorffii|238
MGVADTIIGICGNIAALVLFLVPAKTFNTIRKKKSTLDFSGIPYVTTLLNCLLWVLYGLP
VNKGNVLVMTINSSGIVIQTVYILLFLYYASKILGIFVFDIVATAALGAGVILGVHSKAT
RITILGISCVVLNIGMYYAPLSVMWLVIKTKSNEYMPFLLSLMVLINSSFWTIYAFLLMD
IYIIIPNTLGLAGGIFQMILYFCYRKPAQQVEGDARSTSKADVEIGRMEQKQNSTRTF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: D8TCK3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D8TCK3_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 3.9% allowed 1.7% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D8TCK3_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.1% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D8TCK3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.5% allowed 1.7% week .6% disallowed
Gene Informationback to top
Gene ID: 9640859 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA