Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D8TCK3

dbSWEET id: dbswt_771

Accession:   D8TCK3

Uniprot status:   Unreviewed

Organism:   Selaginella moellendorffii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.

Sequence Information back to top


Sequence length:   238

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|D8TCK3|D8TCK3_SELML|Unreviewed|Selaginella_moellendorffii|238
MGVADTIIGICGNIAALVLFLVPAKTFNTIRKKKSTLDFSGIPYVTTLLNCLLWVLYGLP
VNKGNVLVMTINSSGIVIQTVYILLFLYYASKILGIFVFDIVATAALGAGVILGVHSKAT
RITILGISCVVLNIGMYYAPLSVMWLVIKTKSNEYMPFLLSLMVLINSSFWTIYAFLLMD
IYIIIPNTLGLAGGIFQMILYFCYRKPAQQVEGDARSTSKADVEIGRMEQKQNSTRTF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: D8TCK3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D8TCK3_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.9% favored    3.9% allowed    1.7% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D8TCK3_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    6.1% allowed    .6% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D8TCK3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.5% allowed    1.7% week    .6% disallowed

Gene Informationback to top


Gene ID:   9640859     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur