| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D8SQQ9
dbSWEET id: dbswt_770
Accession: D8SQQ9
Uniprot status: Unreviewed
Organism: Selaginella moellendorffii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.
Sequence Information back to top
Sequence length: 498
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|D8SQQ9|D8SQQ9_SELML|Unreviewed|Selaginella_moellendorffii|498
MGSGTVALGVLGNITAMIMFFSPLPTFSIIYKQKDTGRFSAFPYVCTLMNCLLWFFYGLP
IISENNILVLTINGAGIVIEAVYLVIFIYYAAWPVKTQVLRSLVFVIFFCAITFAITLGA
FEGDDRTTFLGSINVIINTMMYAAPLSVMKMVIETKSVEYMPFMLSLCSFVNATIWALYG
ILKQDKFIIIPNGLGVLLGALQLGLYAKYRKYKTPPASLTEGIAAAYTTEGATATDLSDI
ITRGTTDLSEAISTSAGTAGRILPSPPAAMPGAPPTTAAAKHIHSESLKVEIMGGRKDEI
KPSHRLMKAPSAPDPVVSRPDYARTASAPAPQPPPSTQTQAPGLKPVPTFKVSPPSPSPP
PPPEEAQQPSTAVEALSGVAKVMEAVKEAPKTFKDAVLKETPPPPAVLPKIKETVSVVTP
KIKELAREVTSKVAPSGRDQPTKAPDEVADEAKARKDQEEAFARMKAQEEQKRADELRRL
QEAFDEEEYGAELETIFL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: D8SQQ9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D8SQQ9_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.0% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D8SQQ9_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.6% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D8SQQ9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 9653825 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA