Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D8SAE7
dbSWEET id: dbswt_776
Accession: D8SAE7
Uniprot status: Unreviewed
Organism: Selaginella moellendorffii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.
Sequence Information back to top
Sequence length: 263
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|D8SAE7|D8SAE7_SELML|Unreviewed|Selaginella_moellendorffii|263
MAIAATIIGVAGNVVAALMFLSSILTFIRIAKKKSTESFSSVPYIASLLNCILWVLYGSP
INKNATLVVTINGLGTVLNVIYVLLFLFYARKSPKALKRASLYTFSCLAIMAAVGFGISL
GIHSKDTRITIFGVLCIVLNIAMYWSPLSVMYRIFKTKSVEFLPFYLCLTVFINSALWFA
YALLKHDIYILVPNVLGLAGGAVQLFCHYIYYKPGNLLTWQVPDEKEAEESESPDLESGI
ELPKQNGKFVDVALNTSTMATQS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: D8SAE7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D8SAE7_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.7% allowed .5% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D8SAE7_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.7% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D8SAE7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed 1.0% week .5% disallowed
Gene Informationback to top
Gene ID: 9647745 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA