Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D8R1I5

dbSWEET id: dbswt_773

Accession:   D8R1I5

Uniprot status:   Unreviewed

Organism:   Selaginella moellendorffii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.

Sequence Information back to top


Sequence length:   211

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|D8R1I5|D8R1I5_SELML|Unreviewed|Selaginella_moellendorffii|211
MAIAATIIGVAGNVVAALMFLSSILTFIRIAKKKSTESFSSVPYIASLLNCILWVLYGSP
INKNAMLVVTINGLGTVLNVIYVLLFLFYARKSPKALKRTSLYTFSCLALMAAVGFGISL
GIHSKDTRITIFGVLCIVLNIAMYWSPLSVMYRIFKTKSVEFLPFYLCLTVFINSALWFV
YALLKHDIYILVPNVLGLAGGAVQLFCHYIY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: D8R1I5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D8R1I5_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    5.8% allowed    1.6% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D8R1I5_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    5.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D8R1I5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.8% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur