Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D8R1I5
dbSWEET id: dbswt_773
Accession: D8R1I5
Uniprot status: Unreviewed
Organism: Selaginella moellendorffii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Lycopodiidae ⇒ Selaginellales ⇒ Selaginellaceae ⇒ Selaginella.
Sequence Information back to top
Sequence length: 211
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|D8R1I5|D8R1I5_SELML|Unreviewed|Selaginella_moellendorffii|211
MAIAATIIGVAGNVVAALMFLSSILTFIRIAKKKSTESFSSVPYIASLLNCILWVLYGSP
INKNAMLVVTINGLGTVLNVIYVLLFLFYARKSPKALKRTSLYTFSCLALMAAVGFGISL
GIHSKDTRITIFGVLCIVLNIAMYWSPLSVMYRIFKTKSVEFLPFYLCLTVFINSALWFV
YALLKHDIYILVPNVLGLAGGAVQLFCHYIY
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 212
Alignment file: D8R1I5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D8R1I5_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 5.8% allowed 1.6% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D8R1I5_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D8R1I5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.8% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA