| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D8MEH3
dbSWEET id: dbswt_1716
Accession: D8MEH3
Uniprot status: Unreviewed
Organism: Leuconostoc gelidum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D8MEH3|D8MEH3_LEUGG|Unreviewed|Leuconostoc gelidum|86
MKHEKFIEYLSWTATAMSILMYVSYIPQIIDNLSGSKGNPVQPLVAAVNCGLWVLYGLIK
EDRDIPLATANFPGIIFGFVTFLTAI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: D8MEH3_inward.pdb Alignment file: D8MEH3_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 11.1% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: D8MEH3_outward.pdb Alignment file: D8MEH3_out.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 11.1% allowed 1.6% week .0% disallowed Occluded: Model structure: D8MEH3_occluded.pdb Alignment file: D8MEH3_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA